IL17 (IL17A) (NM_002190) Human Recombinant Protein

CAT#: TP723199

Reviews ()
Write a review

Purified recombinant protein of Human interleukin 17A (IL17A).


 Product Datasheet for 'TP723199'

  View other "IL17A" proteins (9)

USD 230.00


Availability*
5 Days

Size
    • 25 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human interleukin 17A (IL17A).
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Tag Tag Free
Predicted MW 31.3 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Assay #1: ED50 as determined by the dose-dependent induction of IL-6 in primary human foreskin fibroblasts was found to be approximately 2 ng/ml. Assay #2: Measured by its ability to induce IL-6 production by NHDF cells.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_002181
Locus ID 3605
Refseq Size 1859
Cytogenetics 6p12.2
Refseq ORF 465
Synonyms CTLA-8; CTLA8; IL-17; IL-17A; IL17
Summary The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction

Documents

Other Versions

Other products for "IL17A"
Frequently bought together (1)
lL-17 biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone OTI4D17
    • 50 ug

USD 360.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones
HUMAN PROREINS 101