Igf1 (NM_001111274) Mouse Recombinant Protein

CAT#: TP723177

Reviews ()
Write a review

Purified recombinant protein of Mouse insulin-like growth factor 1 (Igf1), transcript variant 3.


Product Datasheet for 'TP723177'


  View other "Igf1" proteins (2)

USD 240.00


Availability*
5 Days

Size
    • 50 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse insulin-like growth factor 1 (Igf1), transcript variant 3.
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
Tag Tag Free
Predicted MW 7.6 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity The ED50 was determined a cell proliferation assay using FDC-P1 cells is<2.0 ng/ml, corresponding to a specific activity of >5 x 10^5 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_001104744
Locus ID 16000
Refseq Size 7039
Cytogenetics 10 43.7 cM
Refseq ORF 429
Synonyms C730016P09Rik; Igf-1; Igf-I
Summary This gene encodes a member of the insulin-like growth factor (IGF) family of proteins that promote growth and development during fetal and postnatal life. This gene is predominantly expressed in the liver and the encoded protein undergoes proteolytic processing to generate a disulfide-linked mature polypeptide. Transgenic disruption of this gene in mice results in reduced postnatal survival and severe growth retardation. Mice lacking the encoded protein exhibit generalized organ hypoplasia including underdevelopment of the central nervous system and developmental defects in bone, muscle and reproductive systems. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015]

Documents

Other Versions

Other products for "Igf1"
Frequently bought together (1)
Anti-Murine IGF-I Goat Polyclonal Antibody
    • 100 ug

USD 285.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101