IGF1 (NM_000618) Human Recombinant Protein

CAT#: TP723176

Reviews ()
Write a review

Purified recombinant protein of Human insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 4.


Product Datasheet for 'TP723176'


  View other "IGF1" proteins (11)

USD 240.00


Availability*
5 Days

Size
    • 100 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human insulin-like growth factor 1 (somatomedin C) (IGF1), transcript variant 4.
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Tag Tag Free
Predicted MW 7.6 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity ED50 was determined by a cell proliferation assay using FDC-P1 cells is less than or equal to 2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_000609
Locus ID 3479
Refseq Size 7260
Cytogenetics 12q23.2
Refseq ORF 459
Synonyms IGF; IGF-I; IGFI; MGF
Summary The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways Dilated cardiomyopathy, Focal adhesion, Glioma, Hypertrophic cardiomyopathy (HCM), Long-term depression, Melanoma, mTOR signaling pathway, Oocyte meiosis, p53 signaling pathway, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer

Documents

Other Versions

Other products for "IGF1"
Frequently bought together (1)
IGF1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101