IGFBP6 (NM_002178) Human Recombinant Protein

CAT#: TP723174

Reviews ()
Write a review

Purified recombinant protein of Human insulin-like growth factor binding protein 6 (IGFBP6).


Product Datasheet for 'TP723174'


  View other "IGFBP6" proteins (4)

USD 240.00


Availability*
5 Days

Size
    • 20 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human insulin-like growth factor binding protein 6 (IGFBP6).
Species Human
Expression Host Hi-5 insect
Expression cDNA Clone or AA Sequence RCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Tag Tag Free
Predicted MW 22.6 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to inhibit IGF-II induced proliferation of human MCF-7 cells. The expected ED50 for this effect is 0.1 - 0.4ug/mL.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_002169
Locus ID 3489
Refseq Size 980
Cytogenetics 12q13.13
Refseq ORF 720
Synonyms IBP6
Summary IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. [UniProtKB/Swiss-Prot Function]
Protein Families Secreted Protein

Documents

Other Versions

Other products for "IGFBP6"
Frequently bought together (1)
Goat Polyclonal Antibody against IGFBP6
    • 100 ug

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101