Ifng (NM_138880) Rat Recombinant Protein

CAT#: TP723164

Reviews ()
Write a review

Purified recombinant protein of Rat interferon gamma (Ifng).


Product Datasheet for 'TP723164'


  View other "Ifng" proteins (2)

USD 140.00


Availability*
5 Days

Size
    • 20 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat interferon gamma (Ifng).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence MQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Tag Tag Free
Predicted MW 15.6 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity ED50 as determined by a cytopathic affect inhibition assay with murine L929 cells challenged with EMC virus was < 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_620235
Locus ID 25712
Refseq Size 525
Cytogenetics 7q22
Refseq ORF 468
Synonyms IFNG2
Summary an immune molecule produced by T lymphocytes in response to mitogens or antigens [RGD, Feb 2006]

Documents

Other Versions

Other products for "Ifng"
Frequently bought together (1)
Anti-Rat IFN-? Goat Polyclonal Antibody
    • 100 ug

USD 285.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101