Ifng (NM_008337) Mouse Recombinant Protein

CAT#: TP723163

Reviews ()
Write a review

Purified recombinant protein of Mouse interferon gamma (Ifng).


Product Datasheet for 'TP723163'


  View other "Ifng" proteins (2)

USD 140.00


Availability*
5 Days

Size
    • 20 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse interferon gamma (Ifng).
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Tag Tag Free
Predicted MW 15.6 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to inhibit the proliferation of murine WEHI-279 cells. The expected ED50 is less than or equal to 0.2 ng/ml, corresponding to a specific activity of > 5 x 10^6 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_032363
Locus ID 15978
Refseq Size 1207
Cytogenetics 10 66.75 cM
Refseq ORF 465
Synonyms Ifg; IFN-g
Summary This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mice deficient in this gene have increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015]

Documents

Other Versions

Other products for "Ifng"
Frequently bought together (1)
Anti-Murine IFN-? Rabbit Polyclonal Antibody
    • 100 ug

USD 285.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101