Interferon beta (IFNB1) (NM_002176) Human Recombinant Protein

CAT#: TP723161

Reviews ()
Write a review

Purified recombinant protein of Human interferon, beta 1, fibroblast (IFNB1).


Product Datasheet for 'TP723161'


  View other "IFNB1" proteins (2)

USD 240.00


Availability*
2 Weeks

Size
    • 20 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human interferon, beta 1, fibroblast (IFNB1).
Species Human
Expression Host CHO
Expression cDNA Clone or AA Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Tag Tag Free
Predicted MW 20 kDa
Concentration Centrifuge the vial prior to opening. Reconstitute the protein in water to a concnetration of 0.1 ~ 1.0 mg/ml. Do not vertex. For extended storage, it is recommended to further dilute in a proper buffer (i.e. water or PBS) containing a carrier protein such as 0.1% BSA, and store in working aliquots at -20°C or -80°C
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Assay #1:Measured by its ability to induce apoptosis in HeLa cells. The expected ED50 for this effect is 20-30 ng/ml. Assay #2:Determined by its ability to stimulate the proliferation of human TF-1 cells. The expected ED50 is less than or equal to 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_002167
Locus ID 3456
Refseq Size 840
Cytogenetics 9p21.3
Refseq ORF 561
Synonyms IFB; IFF; IFN-beta; IFNB
Summary This gene encodes a cytokine that belongs to the interferon family of signaling proteins, which are released as part of the innate immune response to pathogens. The protein encoded by this gene belongs to the type I class of interferons, which are important for defense against viral infections. In addition, type I interferons are involved in cell differentiation and anti-tumor defenses. Following secretion in response to a pathogen, type I interferons bind a homologous receptor complex and induce transcription of genes such as those encoding inflammatory cytokines and chemokines. Overactivation of type I interferon secretion is linked to autoimmune diseases. Mice deficient for this gene display several phenotypes including defects in B cell maturation and increased susceptibility to viral infection. [provided by RefSeq, Sep 2015]
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway

Documents

Other Versions

Other products for "IFNB1"
Frequently bought together (1)
Rabbit Polyclonal IFN-beta Antibody
    • 100 ug

USD 430.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101