NRG1 (NM_013962) Human Recombinant Protein

CAT#: TP723155

Purified recombinant protein of Human neuregulin 1 (NRG1), transcript variant GGF2.


 Product Datasheet for 'TP723155'

  View other "NRG1" proteins (22)

Use code "PROTEIN10" to save 10%

USD 230.00


Availability*
5 Days

Size
    • 50 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human neuregulin 1 (NRG1), transcript variant GGF2.
Species Human
Expression Host E.Coli
Expression cDNA Clone or AA Sequence SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
Tag Tag Free
Predicted MW 7.5 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity ED50 was determined by the dose-dependent stimulation of the proliferation of human MCF-7 cells is less than or equal to 0.5 ng/ml, corresponding to a specific activity of >2 x 10^6 units/mg.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_001153467
Locus ID 3084
Refseq Size 1986
Cytogenetics 8p12
Refseq ORF 1266
Synonyms ARIA; GGF; GGF2; HGL; HRG; HRG1; HRGA; MST131; MSTP131; NDF; NRG1-IT2; SMDF
Summary The protein encoded by this gene is a membrane glycoprotein that mediates cell-cell signaling and plays a critical role in the growth and development of multiple organ systems. An extraordinary variety of different isoforms are produced from this gene through alternative promoter usage and splicing. These isoforms are expressed in a tissue-specific manner and differ significantly in their structure, and are classified as types I, II, III, IV, V and VI. Dysregulation of this gene has been linked to diseases such as cancer, schizophrenia, and bipolar disorder (BPD). [provided by RefSeq, Apr 2016].
Protein Families Secreted Protein, Transmembrane, Transcription Factors, Druggable Genome
Protein Pathways ErbB signaling pathway

Documents

Other Versions

Other products for "NRG1"
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies