GRO alpha (CXCL1) (NM_001511) Human Recombinant Protein

CAT#: TP723148

Reviews ()
Write a review

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1).



  View other "CXCL1" proteins (2)

USD 240.00


Availability*
5 Days

Size
    • 25 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1).
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Tag Tag Free
Predicted MW 7.8 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to chemoattract human neutrophils using a concentration range of 10.0-50.0 ng/ml.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_001502
Locus ID 2919
Refseq Size 1184
Cytogenetics 4q13.3
Refseq ORF 321
Synonyms FSP; GRO1; GROa; MGSA; MGSA-a; NAP-3; SCYB1
Summary This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Sep 2014]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Epithelial cell signaling in Helicobacter pylori infection, NOD-like receptor signaling pathway

Documents

Other Versions

Other products for "CXCL1"
Frequently bought together (1)
Anti-Human GRO/MGSA Rabbit Polyclonal Antibody
    • 100 ug

USD 285.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101