Gdnf (NM_019139) Rat Recombinant Protein

CAT#: TP723139

Reviews ()
Write a review

Purified recombinant protein of Rat glial cell derived neurotrophic factor (Gdnf).



  View other "Gdnf" proteins (1)

USD 240.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat glial cell derived neurotrophic factor (Gdnf).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCEAAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDSLVYHILRKHSAKRCGCI
Tag Tag Free
Predicted MW 15 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to stimulate the proliferation of rat C6 cells.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_062012
Locus ID 25453
Refseq Size 700
Cytogenetics 2q16
Refseq ORF 633
Synonyms gndf
Summary neurotrophic factor specific for midbrain dopamine neurons; binds to GDNFR-alpha and mediates activation of the Ret protein tyrosine kinase receptor [RGD, Feb 2006]

Documents

Other Versions

Other products for "Gdnf"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101