Gdnf (NM_019139) Rat Recombinant Protein

CAT#: TP723139

Purified recombinant protein of Rat glial cell derived neurotrophic factor (Gdnf).


 Product Datasheet for 'TP723139'

  View other "Gdnf" proteins (1)

USD 230.00


Availability*
5 Days

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat glial cell derived neurotrophic factor (Gdnf).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCEAAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDSLVYHILRKHSAKRCGCI
Tag Tag Free
Predicted MW 15 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to stimulate the proliferation of rat C6 cells.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_062012
Locus ID 25453
Refseq Size 700
Refseq ORF 633
Synonyms gndf

Documents

Other Versions

Other products for "Gdnf"
Frequently bought together (1)
Rabbit Polyclonal Anti-GDNF
    • 200 ul

USD 585.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones