GDF7 (NM_182828) Human Recombinant Protein

CAT#: TP723136

Purified recombinant protein of Human growth differentiation factor 7 (GDF7).


 Product Datasheet for 'TP723136'

  View other "GDF7" proteins (1)

USD 230.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human growth differentiation factor 7 (GDF7).
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Tag Tag Free
Predicted MW 28 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to inhibit induced alkaline phosphatase production by ATDC-5 chondrogenic cells.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_878248
Locus ID 151449
Refseq Size 1994
Cytogenetics 2p24.1
Refseq ORF 1350
Synonyms BMP12
Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein may play a role in the differentiation of tendon cells and spinal cord interneurons. A mutation in this gene may be associated with increased risk for Barrett's esophagus and esophageal adenocarcinoma. [provided by RefSeq, Sep 2016]
Protein Families Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - TGFb/BMP signaling pathway
Protein Pathways TGF-beta signaling pathway

Documents

Other Versions

Other products for "GDF7"
Frequently bought together (1)
Rabbit Polyclonal Anti-GDF7 Antibody
    • 100 ul

USD 335.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones