GDF 5 (GDF5) (NM_000557) Human Recombinant Protein

CAT#: TP723134

Reviews ()
Write a review

Purified recombinant protein of Human growth differentiation factor 5 (GDF5).


 Product Datasheet for 'TP723134'

  View other "GDF5" proteins (4)

USD 230.00


Availability*
2 Weeks

Size
    • 50 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human growth differentiation factor 5 (GDF5).
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence APSATRQGKRPSKNLKARCSRKALHVNFKAPSATRQGKRPSKNLKARCSRKALHVNFKDMGWDDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Tag Tag Free
Predicted MW 27 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity ED50 was determined by its ability to induce alkaline phosphatase production by ATDC-5 chondrogenic cells is 1.0-2.0 ug/ml.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_000548
Locus ID 8200
Refseq Size 2344
Cytogenetics 20q11.22
Refseq ORF 1503
Synonyms BDA1C; BMP-14; BMP14; CDMP1; LAP-4; LAP4; OS5; SYM1B; SYNS2
Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates the development of numerous tissue and cell types, including cartilage, joints, brown fat, teeth, and the growth of neuronal axons and dendrites. Mutations in this gene are associated with acromesomelic dysplasia, brachydactyly, chondrodysplasia, multiple synostoses syndrome, proximal symphalangism, and susceptibility to osteoarthritis. [provided by RefSeq, Aug 2016]
Protein Families Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - TGFb/BMP signaling pathway
Protein Pathways Cytokine-cytokine receptor interaction, TGF-beta signaling pathway

Documents

Other Versions

Other products for "GDF5"
Frequently bought together (1)
Rabbit Polyclonal Anti-GDF5 Antibody
    • 100 ul

USD 360.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones
HUMAN PROREINS 101