GDF15 (NM_004864) Human Recombinant Protein

CAT#: TP723131

Reviews ()
Write a review

Purified recombinant protein of Human growth differentiation factor 15 (GDF15).


Product Datasheet for 'TP723131'


  View other "GDF15" proteins (2)

USD 240.00


Availability*
5 Days

Size
    • 20 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human growth differentiation factor 15 (GDF15).
Species Human
Expression Host CHO
Expression cDNA Clone or AA Sequence ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Tag Tag Free
Predicted MW 12 kDa
Concentration Centrifuge the vial prior to opening. Reconstitute the protein in water to a concnetration of 0.1 ~ 1.0 mg/ml. Do not vertex. For extended storage, it is recommended to further dilute in a proper buffer containing a carrier protein such as 0.1% BSA, and store in working aliquots at -20°C or -80°C
Purity ≥ 95% by SDS-PAGE gel and HPLC analyses
Buffer Lyophilized from a 0.2 µM filtered solution of 10mM Sodium Citrate, pH3.0
Bioactivity Determined by its ability to inhibit alkaline phosphatase activity in differentiating MC3T3/E1 osteoblastcells. The expected ED50 for this effect is 75-200 ng/ml.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_004855
Locus ID 9518
Refseq Size 1220
Cytogenetics 19p13.11
Refseq ORF 924
Synonyms GDF-15; MIC-1; MIC1; NAG-1; PDF; PLAB; PTGFB
Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress response program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress. [provided by RefSeq, Aug 2016]
Protein Families Druggable Genome, Secreted Protein

Documents

Other Versions

Other products for "GDF15"
Frequently bought together (1)
GDF15 Goat Polyclonal (C-Terminus) Antibody
    • 50 ug

USD 425.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101