Adiponectin (ADIPOQ) (NM_004797) Human Recombinant Protein

CAT#: TP723122

Reviews ()
Write a review

Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2.



  View other "ADIPOQ" proteins (13)

USD 240.00


Availability*
5 Days

Size
    • 25 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2.
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence PGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Tag Tag Free
Predicted MW 18.1 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by a cytotoxicity assay using M1 cells. The expected ED50 for this effect is 0.5-1.0 ug/ml.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_004788
Locus ID 9370
Refseq Size 4592
Cytogenetics 3q27.3
Refseq ORF 732
Synonyms ACDC; ACRP30; ADIPQTL1; ADPN; APM-1; APM1; GBP28
Summary This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Adipocytokine signaling pathway, PPAR signaling pathway, Type II diabetes mellitus

Documents

Other Versions

Other products for "ADIPOQ"
Frequently bought together (1)
ADIPOQ (Adiponectin) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101