Adipoq (NM_009605) Mouse Recombinant Protein

CAT#: TP723120

Reviews ()
Write a review

Purified recombinant protein of Mouse adiponectin, C1Q and collagen domain containing (Adipoq).


Product Datasheet for 'TP723120'


  View other "Adipoq" proteins (3)

USD 240.00


Availability*
5 Days

Size
    • 25 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse adiponectin, C1Q and collagen domain containing (Adipoq).
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence MKGEPGEAAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Tag Tag Free
Predicted MW 16.6 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to inhibit the proliferation of murine myeloid cell lines M1. ED50 for this effect is less than or equal to 15 ug/ml.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Reference Data
RefSeq NP_033735
Locus ID 11450
Refseq Size 1233
Cytogenetics 16 13.96 cM
Refseq ORF 741
Synonyms 30kDa; Acdc; Acrp30; Ad; Adid; adipo; apM1; APN; GBP28

Documents

Other Versions

Other products for "Adipoq"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101