SFRP1 (NM_003012) Human Recombinant Protein

CAT#: TP723118

Reviews ()
Write a review

Purified recombinant protein of Human secreted frizzled-related protein 1 (SFRP1).


 Product Datasheet for 'TP723118'

  View other "SFRP1" proteins (2)

USD 230.00

USD 399.00


Availability*
2 Weeks

Size
    • 20 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human secreted frizzled-related protein 1 (SFRP1).
Species Human
Expression Host HeLa
Expression cDNA Clone or AA Sequence SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK
Tag Tag Free
Predicted MW 31.1 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to inhibit BMP-2 proliferation effect of ATDC-5 cells. The expected ED50 is 0.3-0.5ug/mL.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_003003
Locus ID 6422
Refseq Size 4465
Cytogenetics 8p11.21
Refseq ORF 942
Synonyms FRP; FRP-1; FRP1; FrzA; SARP2
Summary This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. Members of this family act as soluble modulators of Wnt signaling; epigenetic silencing of SFRP genes leads to deregulated activation of the Wnt-pathway which is associated with cancer. This gene may also be involved in determining the polarity of photoreceptor cells in the retina. [provided by RefSeq, Sep 2009]
Protein Families Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway, Transmembrane
Protein Pathways Wnt signaling pathway

Documents

Other Versions

Other products for "SFRP1"
Frequently bought together (1)
Anti-SFRP1 Rabbit Polyclonal Antibody
    • 100 ul

USD 335.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones
HUMAN PROREINS 101