Cx3cl1 (NM_134455) Rat Recombinant Protein

CAT#: TP723117

Reviews ()
Write a review

Purified recombinant protein of Rat chemokine (C-X3-C motif) ligand 1 (Cx3cl1).



  View other "Cx3cl1" proteins (1)

USD 240.00


Availability*
2 Weeks

Size
    • 20 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat chemokine (C-X3-C motif) ligand 1 (Cx3cl1).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence QHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTRNG
Tag Tag Free
Predicted MW 8.7 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to chemoattract human monocytes using a concentration range of 5.0-10.0 ng/ml.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_604450
Locus ID 89808
Refseq Size 3044
Cytogenetics 19p13
Refseq ORF 1179
Synonyms Cx3c; Scyd1
Summary chemokine that binds its receptor CX3CR1; induces chemotaxis and increased intracellular calcium levels in microglia [RGD, Feb 2006]

Documents

Other Versions

Other products for "Cx3cl1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101