Flt3 ligand (FLT3LG) (NM_001459) Human Recombinant Protein

CAT#: TP723113

Reviews ()
Write a review

Purified recombinant protein of Human fms-related tyrosine kinase 3 ligand (FLT3LG), transcript variant 3.


Product Datasheet for 'TP723113'


  View other "FLT3LG" proteins (5)

USD 240.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human fms-related tyrosine kinase 3 ligand (FLT3LG), transcript variant 3.
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA
Tag Tag Free
Predicted MW 17.6 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity ED50 was determined by the dose-dependent stimulation of the proliferation of human AML5 cells is less than or equal to 1.0 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Reference Data
RefSeq NP_001450
Locus ID 2323
Refseq Size 1074
Cytogenetics 19q13.33
Refseq ORF 705
Synonyms FL; FLG3L; FLT3L
Summary Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al., 2010 [PubMed 20933441]). [supplied by OMIM, Jan 2011]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Pathways in cancer

Documents

Other Versions

Other products for "FLT3LG"
Frequently bought together (1)
Anti-FLT3LG (Flt3 ligand) mouse monoclonal antibody, clone OTI8D10 (formerly 8D10)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101