FGF2 (NM_002006) Human Recombinant Protein

CAT#: TP723110

Purified recombinant protein of Human fibroblast growth factor 2 (basic) (FGF2).


 Product Datasheet for 'TP723110'

Need it in bulk or customized?
Get a free quote

USD 139.00

USD 199.00


Availability*
2 Weeks

Size
    • 50 ug

Product images

Specifications

Product Data
Description Purified recombinant protein of Human fibroblast growth factor 2 (basic) (FGF2).
Species Human
Expression Host E.Coli
Expression cDNA Clone or AA Sequence AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Tag Tag Free
Predicted MW 17.2 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Assay #1: ED50 as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors is less than or equal to 0.5 ng/ml, corresponding to a specific activity of > 2 x 10^6 units/mg. Assay #2: ED50 was determined by a cell proliferation assay using balb/c 3T3 cells is less than or equal to 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_001997
Locus ID 2247
Refseq Size 6803
Cytogenetics 4q28.1
Refseq ORF 864
Synonyms BFGF; FGF-2; FGFB; HBGF-2
Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. [provided by RefSeq, Jul 2008].
Protein Families Secreted Protein, Druggable Genome
Protein Pathways MAPK signaling pathway, Regulation of actin cytoskeleton, Pathways in cancer, Melanoma
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents