Fgf2 (NM_019305) Rat Recombinant Protein

CAT#: TP723108

Reviews ()
Write a review

Purified recombinant protein of Rat fibroblast growth factor 2 (Fgf2).



  View other "Fgf2" proteins (4)

USD 240.00


Availability*
5 Days

Size
    • 50 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat fibroblast growth factor 2 (Fgf2).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence PALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Tag Tag Free
Predicted MW 16.3 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity ED50 as determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells is less than or equal to 0.2 ng/ml corresponding to a specific activity of >5 x 10^6 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_062178
Locus ID 54250
Refseq Size 1016
Cytogenetics 2q25
Refseq ORF 462
Synonyms bFGF; Fgf-2
Summary activates the MAP kinase signaling pathway; plays a role in synaptic transmission; induces cell proliferation [RGD, Feb 2006]

Documents

Other Versions

Other products for "Fgf2"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101