Fgf2 (NM_008006) Mouse Recombinant Protein

CAT#: TP723107

Purified recombinant protein of Mouse fibroblast growth factor 2 (Fgf2).


 Product Datasheet for 'TP723107'

Need it in bulk or customized?
Get a free quote

USD 139.00

USD 199.00


Availability*
2 Weeks

Size
    • 50 ug

Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse fibroblast growth factor 2 (Fgf2).
Species Mouse
Expression Host E.Coli
Expression cDNA Clone or AA Sequence PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Tag Tag Free
Predicted MW 15.9 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Assay #1: ED50 as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors is less than or equal to 0.1 ng/ml corresponding to a specific activity of > 1 x 10^7 units/mg. Assay #2: ED50 was determined by a cell proliferation assay using balb/c 3T3 cells is less than or equal to 1.0 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_032032
Locus ID 14173
Refseq Size 695
Refseq ORF 462
Synonyms bFGF; Fgf-2; Fgfb
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents