Fgf2 (NM_008006) Mouse Recombinant Protein

CAT#: TP723107

Reviews ()
Write a review

Purified recombinant protein of Mouse fibroblast growth factor 2 (Fgf2).


Product Datasheet for 'TP723107'


  View other "Fgf2" proteins (4)

USD 240.00


Availability*
2 Weeks

Size
    • 50 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse fibroblast growth factor 2 (Fgf2).
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Tag Tag Free
Predicted MW 15.9 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by a cell proliferation assay using Balb/c 3T3 cells. The expected ED50 is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1 x 10^6 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Reference Data
RefSeq NP_032032
Locus ID 14173
Refseq Size 695
Cytogenetics 3 18.41 cM
Refseq ORF 462
Synonyms bFGF; Fgf-2; Fgfb

Documents

Other Versions

Other products for "Fgf2"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101