Fgf1 (NM_012846) Rat Recombinant Protein

CAT#: TP723106

Reviews ()
Write a review

Purified recombinant protein of Rat fibroblast growth factor 1 (Fgf1).



  View other "Fgf1" proteins (3)

USD 240.00


Availability*
5 Days

Size
    • 50 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Rat fibroblast growth factor 1 (Fgf1).
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Tag Tag Free
Predicted MW 15.9 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by a cell proliferation assay using balb/c 3T3 cells. The expected ED50 is less than or equal to 0.1 ng/ml, in the presence of 10 ug/ml heparin, corresponding to a specific activity of > 1 x 10^7 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_036978
Locus ID 25317
Refseq Size 1216
Cytogenetics 18p11
Refseq ORF 465
Synonyms FGF-1; HBGF-1; HBGF1
Summary may play a role in neurite outgrowth; may regulate cell differentiation in the nervous system; may act in synergy with fibronectin to enhance neuronal cell adhesion [RGD, Feb 2006]

Documents

Other Versions

Other products for "Fgf1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101