FGF1 (NM_000800) Human Recombinant Protein

CAT#: TP723104

Reviews ()
Write a review

Purified recombinant protein of Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1.



  View other "FGF1" proteins (19)

USD 240.00


Availability*
5 Days

Size
    • 50 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1.
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Tag Tag Free
Predicted MW 16 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by a cell proliferation assay using Balb/c 3T3 cells. The expected ED50 is ≤ 0.5 ng/ml in the presence of 10 µg/ml heparin, corresponding to a specific activity of ≥ 2 x 106 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_000791
Locus ID 2246
Refseq Size 4162
Cytogenetics 5q31.3
Refseq ORF 465
Synonyms AFGF; ECGF; ECGF-beta; ECGFA; ECGFB; FGF-1; FGF-alpha; FGFA; GLIO703; HBGF-1; HBGF1
Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Jan 2009]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton

Documents

Other Versions

Other products for "FGF1"
Frequently bought together (1)
aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101