FGF9 (NM_002010) Human Recombinant Protein

CAT#: TP723102

Reviews ()
Write a review

Purified recombinant protein of Human fibroblast growth factor 9 (glia-activating factor) (FGF9).



  View other "FGF9" proteins (3)

USD 240.00


Availability*
5 Days

Size
    • 20 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human fibroblast growth factor 9 (glia-activating factor) (FGF9).
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence PLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Tag Tag Free
Predicted MW 23.2 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by a cell proliferation assay using Balb/c 3T3 cells. The expected ED50 is = 10 ng/ml, corresponding to a specific activity of = 1 x 10^5 units/mg.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_002001
Locus ID 2254
Refseq Size 1420
Cytogenetics 13q12.11
Refseq ORF 624
Synonyms FGF-9; GAF; HBFG-9; HBGF-9; SYNS3
Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton

Documents

Other Versions

Other products for "FGF9"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101