BMP6 (NM_001718) Human Recombinant Protein

CAT#: TP723046

Reviews ()
Write a review

Purified recombinant protein of Human bone morphogenetic protein 6 (BMP6).


 Product Datasheet for 'TP723046'

  View other "BMP6" proteins (6)

USD 230.00

USD 399.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human bone morphogenetic protein 6 (BMP6).
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence VSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
Tag Tag Free
Predicted MW 26.2 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 this effect is 0.03-0.06ug/mL.
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_001709
Locus ID 654
Refseq Size 2943
Cytogenetics 6p24.3
Refseq ORF 1539
Synonyms VGR; VGR1
Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates a wide range of biological processes including iron homeostasis, fat and bone development, and ovulation. Differential expression of this gene may be associated with progression of breast and prostate cancer. Mutations in this gene may be associated with iron overload in human patients. [provided by RefSeq, Jul 2016]
Protein Families Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Secreted Protein, Stem cell relevant signaling - TGFb/BMP signaling pathway
Protein Pathways Hedgehog signaling pathway, TGF-beta signaling pathway

Documents

Other Versions

Other products for "BMP6"
Frequently bought together (1)
Rabbit Polyclonal Anti-BMP6 Antibody
    • 100 ul

USD 335.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones
HUMAN PROREINS 101