Adipoq (NM_009605) Mouse Recombinant Protein

CAT#: TP723007

Reviews ()
Write a review

Purified recombinant protein of Mouse adiponectin, C1Q and collagen domain containing (Adipoq).


Product Datasheet for 'TP723007'


  View other "Adipoq" proteins (3)

USD 240.00


Availability*
5 Days

Size
    • 25 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Mouse adiponectin, C1Q and collagen domain containing (Adipoq).
Species Mouse
Expression Host Hi-5 insect
Expression cDNA Clone or AA Sequence RGHHHHHHHHVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Tag N-His
Predicted MW 35 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by a cytotoxic assay using M1 cells. The ED50 for this effect is 4.0-6.0ug/mL.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_033735
Locus ID 11450
Refseq Size 1233
Cytogenetics 16 13.96 cM
Refseq ORF 741
Synonyms 30kDa; Acdc; Acrp30; Ad; Adid; adipo; apM1; APN; GBP28

Documents

Other Versions

Other products for "Adipoq"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101