MCP2 (CCL8) (NM_005623) Human Recombinant Protein

CAT#: TP721120

Reviews ()
Write a review

Purified recombinant protein of Human chemokine (C-C motif) ligand 8 (CCL8)



  View other "CCL8" proteins (6)

USD 300.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human chemokine (C-C motif) ligand 8 (CCL8)
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWVRDSMKHLDQIFQNLKPVDHHHHHH*
Tag C-His
Predicted MW 9.95 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM PB,150mM NaCl,1mM EDTA, pH 7.4
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_005614
Locus ID 6355
UniProt ID P80075
Cytogenetics 17q12
Refseq Size 1351
Refseq ORF 297
Synonyms HC14; MCP-2; MCP2; SCYA8; SCYA10
Summary This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils. By recruiting leukocytes to sites of inflammation this cytokine may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection. [provided by RefSeq, Sep 2014]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway

Documents

Other Versions

Other products for "CCL8"
Frequently bought together (1)
Anti-Human MCP-2 Rabbit Polyclonal Antibody
    • 100 ug

USD 285.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools
HUMAN PROREINS 101