Activin Receptor Type IIA (ACVR2A) (NM_001616) Human Recombinant Protein
Purified recombinant protein of Human activin A receptor, type IIA (ACVR2A)
Product images

Specifications
Product Data | |
Description | Purified recombinant protein of Human activin A receptor, type IIA (ACVR2A) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Tag | C-Fc/His |
Predicted MW | 41.2 kDa |
Concentration | lot specific |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001607 |
Locus ID | 92 |
Refseq Size | 5244 |
Cytogenetics | 2q22.3-q23.1 |
Refseq ORF | 1539 |
Synonyms | ACTRII; ACVR2 |
Summary | This gene encodes a receptor that mediates the functions of activins, which are members of the transforming growth factor-beta (TGF-beta) superfamily involved in diverse biological processes. The encoded protein is a transmembrane serine-threonine kinase receptor which mediates signaling by forming heterodimeric complexes with various combinations of type I and type II receptors and ligands in a cell-specific manner. The encoded type II receptor is primarily involved in ligand-binding and includes an extracellular ligand-binding domain, a transmembrane domain and a cytoplasmic serine-threonine kinase domain. This gene may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jun 2013] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419844 | ACVR2A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 110.00 |
|
LY419844 | Transient overexpression lysate of activin A receptor, type IIA (ACVR2A) |
USD 360.00 |
|
TP720687 | Purified recombinant protein of Human activin A receptor, type IIA (ACVR2A) |
USD 300.00 |
USD 379.00