ZNRF1 (NM_032268) Human Recombinant Protein

CAT#: TP720997

Reviews ()
Write a review

Purified recombinant protein of Human zinc and ring finger 1 (ZNRF1)



  View other "ZNRF1" proteins (2)

USD 300.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human zinc and ring finger 1 (ZNRF1)
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence MGSSHHHHHHSSGLVPRGSHMPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTLEHHHHHH
Tag N- and C-His
Predicted MW 14 kDa
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Supplied as a 0.2 µm filtered solution of 20mM Tris, 0.15M NaCl,1mM EDTA,10%glycerol, pH 8.0
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 3 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_115644
Locus ID 84937
Refseq Size 4633
Cytogenetics 16q23.1
Refseq ORF 681
Synonyms NIN283
Summary This gene encodes an E3 ubiquitin-protein ligase that plays a role in neural-cell differentiation. Overexpression of this gene causes neurite-like elongation. The encoded protein contains both a zinc finger and a RING finger motif and is localized in the endosome/lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification, and in synaptic vessicle membranes in neurons. [provided by RefSeq, Feb 2012]
Protein Families Druggable Genome

Documents

Other Versions

Other products for "ZNRF1"
Frequently bought together (1)
Rabbit Polyclonal Anti-ZNRF1 Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101