Alpha Taxilin (TXLNA) (NM_175852) Human Recombinant Protein

CAT#: TP720978

Reviews ()
Write a review

Purified recombinant protein of Human taxilin alpha (TXLNA)



  View other "TXLNA" proteins (4)

USD 300.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human taxilin alpha (TXLNA)
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence MGSSHHHHHHSSGLVPRGSHMKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKLEHHHHHH
Tag N, C-HIS
Predicted MW 20.4 kDa
Concentration Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_787048
Locus ID 200081
Refseq Size 4843
Cytogenetics 1p35.2
Refseq ORF 1638
Synonyms IL14; TXLN
Summary May be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis in neuroendocrine cells. [UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome

Documents

Other Versions

Other products for "TXLNA"
Frequently bought together (1)
Rabbit Polyclonal Anti-TXLNA Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101