ZIK1 (NM_001010879) Human Recombinant Protein

CAT#: TP720930

Reviews ()
Write a review

Purified recombinant protein of Human zinc finger protein interacting with K protein 1 homolog (mouse) (ZIK1)



  View other "ZIK1" proteins (3)

USD 300.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human zinc finger protein interacting with K protein 1 homolog (mouse) (ZIK1)
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence MASMTGGQQMGRGSMAAAALRAPTQVTVSPETHMDLTKGCVTFEDIAIYFSQDEWGLLDEAQRLLYLEVMLENFALVASLGCGHGTEDEETPSDQNVSVGVSQSKAGSSTQKTQSCEMCVPVLKDILHLADLPGQKPYLVGECTNHHQHQKHHSAKKSLKRDMDRASYVKCCLFCMSLKPFRKWEVGKDLPAMLRLLRSLVFPGGKKPGTITECGEDIRSQKSHYKSGECGKASRHKHTPVYHPRVYTGKKLYEC
Tag T7
Predicted MW 45 kDa
Concentration Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µm filtered solution of 20mM Tris, pH 7.5
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_001010879
Locus ID 284307
Refseq Size 2676
Cytogenetics 19q13.43
Refseq ORF 1461
Synonyms ZNF762

Documents

Other Versions

Other products for "ZIK1"
Frequently bought together (1)
Rabbit Polyclonal Anti-ZIK1 Antibody
    • 100 ul

USD 310.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101