CXCL5 (NM_002994) Human Recombinant Protein
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5)
Product images

Specifications
Product Data | |
Description | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5) |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence | MLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN |
Tag | Tag Free |
Predicted MW | 7.95 kDa |
Concentration | lot specific |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB, pH 6.0 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002985 |
Locus ID | 6374 |
Refseq Size | 2505 |
Cytogenetics | 4q13.3 |
Refseq ORF | 342 |
Synonyms | ENA-78; SCYB5 |
Summary | This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. [provided by RefSeq, May 2013] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401049 | CXCL5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 110.00 |
|
LY401049 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 5 (CXCL5) |
USD 360.00 |
|
PH302707 | CXCL5 MS Standard C13 and N15-labeled recombinant protein (NP_002985) |
USD 2,260.00 |
|
TP302707 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5) |
USD 748.00 |
|
TP700192 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R45K mutant, 20 ug |
USD 748.00 |
|
TP700193 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R48K mutant, 20 ug |
USD 748.00 |
|
TP700194 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R45K and R48K double mutant, 20 ug |
USD 748.00 |
|
TP723075 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5). |
USD 240.00 |
|
TP723076 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5). |
USD 240.00 |
|
TP723725 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5 / ENA-78) |
USD 180.00 |
USD 285.00