CXCL5 (NM_002994) Human Recombinant Protein

CAT#: TP720876

Reviews ()
Write a review

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5)


 Product Datasheet for 'TP720876'

  View other "CXCL5" proteins (10)

USD 299.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5)
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence MLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Tag Tag Free
Predicted MW 7.95 kDa
Concentration Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM PB, pH 6.0
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_002985
Locus ID 6374
Refseq Size 2505
Cytogenetics 4q13.3
Refseq ORF 342
Synonyms ENA-78; SCYB5
Summary This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. [provided by RefSeq, May 2013]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction

Documents

Other Versions

Other products for "CXCL5"
Frequently bought together (1)
Rabbit Polyclonal CXCL5 Antibody
    • 100 ug

USD 409.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones
HUMAN PROREINS 101