CDK4 (NM_000075) Human Recombinant Protein

CAT#: TP720874

Reviews ()
Write a review

Purified recombinant protein of Human cyclin-dependent kinase 4 (CDK4)



  View other "CDK4" proteins (4)

USD 300.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human cyclin-dependent kinase 4 (CDK4)
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEAD
Tag N-His
Predicted MW 37.2 kDa
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Supplied as a 0.2 µM filtered solution of PBS, pH 7.4
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 3 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_000066
Locus ID 1019
Refseq Size 2020
Cytogenetics 12q14.1
Refseq ORF 909
Synonyms CMM3; PSK-J3
Summary The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Bladder cancer, Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer, Small cell lung cancer, T cell receptor signaling pathway, Tight junction

Documents

Other Versions

Other products for "CDK4"
Frequently bought together (1)
Rabbit polyclonal CDK4 Antibody (C-term)
    • 400 ul

USD 450.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101