Snx9 (NM_025664) Mouse Recombinant Protein
SKU
TP520304
Purified recombinant protein of Mouse sorting nexin 9 (Snx9), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Mouse |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>MR220304 protein sequence
Red=Cloning site Green=Tags(s) MATKARVMYDFAAEPGNNELTVTEGEIITVTNPNVGGGWLEGKNNKGEQGLVPTDYVEILPNDGKDPFSC GNSVADQAFLDSLTASTAQTNSSSANSNNQVGGGNDPWTAWNAPKPGNWDSSDAWGSRTDGTSAQRNSSA NNWDTGFGHPQAYQGPATGDDDEWDEDWDDPKSSSPYFKDSEPAEAGGIQRGNSRAGASSMKLPLNKFPG FAKPGMEQYLLAKQLAKPKEKIAIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTN RSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVVSESEVF QQFLNFRDEKEWKTGKRKAEKDELVGVMIFSTMEPEAPDLDLIEIEQKCDAVGKFTKAMDDGVKELLTVG QEHWKRCTGPLPKEYQKIGKALQSLAAVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLM ECNHEYKGFLGCFPDIIGAHKGAIEKVKESDKLVATSKITPQDKQTMVKRVGTMSYALQAEMNHFHSNRI YDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 66.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_079940 |
Locus ID | 66616 |
UniProt ID | Q91VH2 |
Cytogenetics | 17 3.51 cM |
RefSeq Size | 2078 |
RefSeq ORF | 1785 |
Synonyms | 2700073N08Rik; SDP1; SH3PX1 |
Summary | Involved in endocytosis and intracellular vesicle trafficking, both during interphase and at the end of mitosis. Required for efficient progress through mitosis and cytokinesis. Required for normal formation of the cleavage furrow at the end of mitosis. Plays a role in endocytosis via clathrin-coated pits, but also clathrin-independent, actin-dependent fluid-phase endocytosis. Plays a role in macropinocytosis. Promotes internalization of TNFR. Promotes degradation of EGFR after EGF signaling. Stimulates the GTPase activity of DNM1. Promotes DNM1 oligomerization. Promotes activation of the Arp2/3 complex by WASL, and thereby plays a role in the reorganization of the F-actin cytoskeleton (PubMed:23437151). Binds to membranes enriched in phosphatidylinositol 4,5-bisphosphate and promotes membrane tubulation. Has lower affinity for membranes enriched in phosphatidylinositol 3-phosphate (By similarity).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.