H1f8 (NM_138311) Mouse Recombinant Protein

CAT#: TP517893

Purified recombinant protein of Mouse H1 histone family, member O, oocyte-specific (H1foo), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR217893 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPGSVSSVSSSSFPSRDTSPSGSCGLPGADKPGPSCRRIQAGQRNPTMLHMVLEALKAREARQGTSVVA
  IKVYIQHKYPTVDTTRFKYLLKQALETGVRRGLLTRPAHSKAKGATGSFKLVPKPKTKKACAPKAGRGAA
  GAKETGSKKSGLLKKDQVGKATMEKGQKRRAYPCKAATLEMAPKKAKAKPKEVRKAPLKQDKAAGAPLTA
  NGGQKVKRSGSRQEANAHGKTKGEKSKPLASKVQNSVASLAKRKMADMAHTVTVVQGAETVQETKVPTPS
  QDIGHKVQPIPRVRKAKTPENTQA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 32.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_612184
• Locus ID: 171506
• UniProt ID: Q8VIK3
• Cytogenetics: 6 E3
• Refseq Size: 1114
• Refseq ORF: 915
• Synonyms: C86609; H1; H1-8; H1.8; H1f; H1fo; H1foo; H1oo
• Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. The protein encoded is a replication-independent histone that is a member of the histone H1 family. This gene contains introns, unlike most histone genes and the encoded protein is expressed only in oocytes. [provided by RefSeq, Oct 2015]