Tigit (NM_001146325) Mouse Recombinant Protein

CAT#: TP513712

Purified recombinant protein of Mouse T cell immunoreceptor with Ig and ITIM domains (Tigit), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR213712 representing NM_001146325
  Red=Cloning site Green=Tags(s)
  
  MHGWLLLVWVQGLIQAAFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIY
  SVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPL
  GGTMAAVLGLICLMVTGVTVLARKKSIRMHSIESGLGRTEAEPQEWNLRSLSSPGSPVQTQTAPAGPCGE
  QAEDDYADPQEYFNVLSYRSLESFIAVSKTG
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 26.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001139797
• Locus ID: 100043314
• UniProt ID: A0A0B4J1G6
• Cytogenetics: 16 B4
• Refseq Size: 963
• Refseq ORF: 726
• Synonyms: ENSMUSG00000071552; Vstm3