Macroh2a1 (NM_001159515) Mouse Recombinant Protein

CAT#: TP505680

Purified recombinant protein of Mouse H2A histone family, member Y (H2afy), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Macroh2a1 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205680 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARD
  NKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKGKLEAIITPPPAKKAKSPS
  QKKPVAKKTGGKKGARKSKKKQGEVSKAASADSTTEGTPTDGFTVLSTKSLFLGQKLQVVQADIASIDSD
  AVVHPTNTDFYTGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAISAGHGLPAKFVIHCNSPVWGA
  DKCEELLEKTVKNCLALADDRKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFML
  FDSESIGIYVQEMAKLDAN
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 39.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001152987
• Locus ID: 26914
• UniProt ID: Q9QZQ8, Q9CTH9
• Cytogenetics: 13 B1
• Refseq Size: 1966
• Refseq ORF: 1110
• Synonyms: H2af; H2AF12; H2AF12M; H2afy; MACROH2; mH2a; mH2a1
• Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2015]