C14orf166 (Rtraf) (NM_026528) Mouse Recombinant Protein

CAT#: TP503050

Reviews ()
Write a review

Purified recombinant protein of Mouse RNA transcription, translation and transport factor (Rtraf), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



USD 988.00

6 Weeks*

Size
    • 20 ug

Product images

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00


RTRAF Antibody - C-terminal region
    • 100 ul

USD 539.00

Other products for "Rtraf"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203050 protein sequence
Red=Cloning site Green=Tags(s)

MFRRKLTALDYHNPSGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLKDVNCP
FKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNRKNTDNAAKNAEPLINLDVNNPDFKAGVMALANL
LQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALEKHILGFDTGDAVLNEAAQILRLLHIE
ELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 28.2 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080804
Locus ID 68045
UniProt ID Q9CQE8, Q4VA29
Cytogenetics 14 A3
Refseq Size 1510
Refseq ORF 735
Synonyms 2700060E02Rik
Summary RNA-binding protein involved in modulation of mRNA transcription by Polymerase II. Component of the tRNA-splicing ligase complex and is required for tRNA ligation. May be required for RNA transport.[UniProtKB/Swiss-Prot Function]

Documents

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.