Mpzl1 (NM_001001880) Mouse Recombinant Protein

CAT#: TP502237

Purified recombinant protein of Mouse myelin protein zero-like 1 (Mpzl1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202237 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEAVGAVALIAAPARRRWLWSVLAAMLGLLTARISALEVHTPKEIFVVNGTQGKLTCTFDSPNTTGWLT
  TVSWSFQPDGTDSAVSFFHYSQGQVYIGDYPPFKDRVTWAGDLDKKDASINIENIQAVHNGTYICDVKNP
  PDIVVRPGHIRLHVVEIDNLLVFLVWVVVGTVTAVVLGLTLLISLVLVVLYRRKHSKRDYTGAQSFTHS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 23 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001001880
• Locus ID: 68481
• UniProt ID: Q3TEW6, A0A0R4J0V2
• Cytogenetics: 1 H2.3
• Refseq Size: 2250
• Refseq ORF: 630
• Synonyms: 1110007A10Rik; PZR
• Summary: Cell surface receptor, which is involved in signal transduction processes. Recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2. Is a major receptor for concanavalin-A (ConA) and is involved in cellular signaling induced by ConA, which probably includes Src family tyrosine-protein kinases. Isoform 2 seems to have a dominant negative role; it blocks tyrosine phosphorylation of MPZL1 induced by ConA. Isoform 1, but not isoform 2, may be involved in regulation of integrin-mediated cell motility (By similarity).[UniProtKB/Swiss-Prot Function]