Myl9 (NM_172118) Mouse Recombinant Protein

CAT#: TP501455

Purified recombinant protein of Mouse myosin, light polypeptide 9, regulatory (Myl9), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201455 representing NM_172118
  Red=Cloning site Green=Tags(s)
  
  MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYL
  EGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVD
  EMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 20.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_742116
• Locus ID: 98932
• UniProt ID: Q9CQ19
• Cytogenetics: 2 H1
• Refseq Size: 1083
• Refseq ORF: 516
• Synonyms: AI327049; MLC20; Mylc2c; RLC-C
• Summary: Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.[UniProtKB/Swiss-Prot Function]