Lgals1 (NM_008495) Mouse Recombinant Protein

CAT#: TP500810

Purified recombinant protein of Mouse lectin, galactose binding, soluble 1 (Lgals1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200810 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MACGLVASNLNLKPGECLKVRGEVASDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNTKEDGTWG
  TEHREPAFPFQPGSIIEVCITFDQADLTIKLPDGHEFKFPNRLNMEAINYMAADGDFKIKCVAFE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 14.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032521
• Locus ID: 16852
• UniProt ID: P16045
• Cytogenetics: 15 37.7 cM
• Refseq Size: 817
• Refseq ORF: 408
• Synonyms: AA410090; Gal-1; Galbp; galectin-1; L-14.5; L14; Lect14
• Summary: Lectin that binds beta-galactoside and a wide array of complex carbohydrates. Plays a role in regulating apoptosis, cell proliferation and cell differentiation. Inhibits CD45 protein phosphatase activity and therefore the dephosphorylation of Lyn kinase. Strong inducer of T-cell apoptosis.[UniProtKB/Swiss-Prot Function]