KCTD7 (NM_001167961) Human Recombinant Protein
CAT#: TP329837
Recombinant protein of human potassium channel tetramerisation domain containing 7 (KCTD7), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229837 representing NM_001167961
Red=Cloning site Green=Tags(s) MVVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPEVVPLNIGGAHFTTRLSTLR CYEDTMLAAMFSGRHYIPTDSEGRYFIDRDGTHFGDVLNFLRSGDLPPRERVRAVYKEAQYYAIGPLLEQ LENMQPLKGEKVRQAFLGLMPYYKDHLERIVEIARLRAVQRKARFAKLKVCVFKEEMPITPYECPLLNSL RFERSESDGQLFEHHCEVDVSFGPWEAVADVYDLLHCLVTDLSAQGLTVDHQCIGVCDKHLVNHYYCKRP IYEFKITW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.4 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001161433 |
Locus ID | 154881 |
UniProt ID | Q96MP8 |
Cytogenetics | 7q11.21 |
Refseq ORF | 864 |
Synonyms | CLN14; EPM3 |
Summary | This gene encodes a member of the potassium channel tetramerization domain-containing protein family. Family members are identified on a structural basis and contain an amino-terminal domain similar to the T1 domain present in the voltage-gated potassium channel. Mutations in this gene have been associated with progressive myoclonic epilepsy-3. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2011] |
Protein Families | Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407179 | KCTD7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432837 | KCTD7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY407179 | Transient overexpression lysate of potassium channel tetramerisation domain containing 7 (KCTD7), transcript variant 1 |
USD 436.00 |
|
LY432837 | Transient overexpression lysate of potassium channel tetramerisation domain containing 7 (KCTD7), transcript variant 2 |
USD 436.00 |
|
TP760892 | Purified recombinant protein of Human potassium channel tetramerisation domain containing 7 (KCTD7), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review