SFTPA1 (NM_001164644) Human Recombinant Protein

CAT#: TP328781SE

Purified recombinant protein of Human surfactant protein A1 (SFTPA1), transcript variant 3, secretory expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified SFTPA1 protein (Cat #TP328781SE). The protein was produced from mammalian cells transfected with SFTPA1 cDNA clone (Cat #RC228781).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC228781 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPP
  GNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFS
  SNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTN
  WYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.8 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001158116
• Locus ID: 653509
• UniProt ID: Q8IWL2, A0A024QZP2
• Cytogenetics: 10q22.3
• Refseq Size: 2189
• Refseq ORF: 744
• Synonyms: COLEC4; PSAP; PSP-A; PSPA; SFTP1; SFTPA1B; SP-A; SP-A1; SP-A1 beta; SP-A1 delta; SP-A1 epsilon; SP-A1 gamma; SPA; SPA1
• Summary: This gene encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]