FAM90A18 (NM_001164451) Human Recombinant Protein

CAT#: TP328382

Purified recombinant protein of Homo sapiens family with sequence similarity 90, member A18 (FAM90A18), 20 µg

Product Images

Coomassie blue staining of purified FAM90A18 protein (Cat# TP328382). The protein was produced from HEK293T cells transfected with FAM90A18 cDNA clone (Cat# RC228382) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC228382 representing NM_001164451
  Red=Cloning site Green=Tags(s)
  
  MMARRDPKSWAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCPMKCWKAALVP
  ATLGKKEGKENLKPWKPRVEANPGPLNKDKGEKEERPRQQDPQRKALLHMFSGKPPEKPLPNGKGSTESS
  DHLRVASGPMPVHTTSKRPRVDPVLADRSAAEMSGRGSVLASLSPLRKASLSSSSSLGPKERQTGAAADM
  PQPAVRHQGREPLLVVKPTHSSPEGGCREVPQAASKTHGLLQAARPQAQDKRPAVTSQPCPPAATHSLGL
  GSNLSFGPGAKRPAQAPIQACLKFPKKPRLGPFQIPESAIQGGELGAPGNLQPPPAATELGPSTSPQMGR
  RTPAQVPSVDWQPPHSTPCLPTAQACTMSHHSAASHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP
  GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 49.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001157923
• Locus ID: 441326
• Cytogenetics: 8p23.1
• Refseq ORF: 1392
• Synonyms: FAM90A19
• Summary: FAM90A18 belongs to subfamily II of the primate-specific FAM90A gene family, which originated from multiple duplications and rearrangements (Bosch et al., 2007 [PubMed 17684299]). For background information on the FAM90A gene family, as well as information on the evolution of FAM90A genes, see FAM90A1 (MIM 613041).[supplied by OMIM, Oct 2009]