PIP4K2C (NM_001146258) Human Recombinant Protein

CAT#: TP328337

Recombinant protein of human phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (PIP4K2C), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified PIP4K2C protein (Cat# TP328337). The protein was produced from HEK293T cells transfected with PIP4K2C cDNA clone (Cat# RC228337) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC228337 representing NM_001146258
  Red=Cloning site Green=Tags(s)
  
  MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVM
  LLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEGSDGR
  FLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHR
  LPVHRKYDLKGSLVSREASDKEKVKELPTLKDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMD
  YSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESF
  IDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF
  A
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 47.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001139730
• Locus ID: 79837
• UniProt ID: Q8TBX8, B3KQV3
• Cytogenetics: 12q13.3
• Refseq ORF: 1263
• Synonyms: PIP5K2C
• Summary: May play an important role in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Inositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton