OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

alpha smooth muscle Actin (ACTA2) (NM_001141945) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP327802
Recombinant protein of human actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA373222 α-Smooth Muscle Actin (ACTA2) Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "alpha smooth muscle Actin or NM_001141945"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC227802 protein sequence
Red=Cloning site Green=Tags(s)

MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK
YPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA
VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI
VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT
YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS
LSTFQQMWISKQEYDEAGPSIVHRKCF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Pull-down assay (PMID: 27991922)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001135417
Locus ID 59
UniProt ID P62736
Cytogenetics 10q23.31
RefSeq Size 1798
RefSeq ORF 1131
Synonyms ACTSA
Summary This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome. provided by RefSeq, Sep 2017
Protein Categories Cardiovascular diseases, Growth Factors, Intracellular Proteins
Protein Pathways Vascular smooth muscle contraction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "alpha smooth muscle Actin" proteins (5)
SKU Description Size Price
PH327802 ACTA2 MS Standard C13 and N15-labeled recombinant protein (NP_001135417) 10 ug
$3,360.00
LC400608 Lyophilized ACTA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427983 Lyophilized ACTA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400608 Transient overexpression lysate of actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427983 Transient overexpression lysate of actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

Phosphoglycerate mutase 1 promotes cancer cell migration independent of its metabolic activity
Zhang, Jin, Sun et al
Oncogene (2016)
AI Summary: In this study, OriGene’s ACTA2 and Profilin-1 recombinant proteins were used in GST pull-down assays to investigate and confirm the direct interaction between PGAM1 and ACTA2, elucidating PGAM1's non-metabolic role in promoting cancer cell migration.
Snippet: GST-pull down assay. In total, 10 μg purified GST fused PGAM1 was incubated with 200 ng ACTA2 (Origene, Rockville, MD, USA) or with the same amount of Profilin-1 (Origene) protein in 200 μl binding buffer (20 mm Tris-HCl pH 8.0, 150 mm NaCl, 1% Nonidet P40 ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products