RIZ1 (PRDM2) (NM_001135610) Human Recombinant Protein

SKU
TP327715
Recombinant protein of human PR domain containing 2, with ZNF domain (PRDM2), transcript variant 4, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC227715 representing NM_001135610
Red=Cloning site Green=Tags(s)

MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVK
NNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWY
NGEDNPEIAAAIEEERASARSKRSSPKSRKATASAWRPDALHQRPRTSPGSIGRSKLQLQPSSRDHSSKS
RHSGCSLTAPEVTWNQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001129082
Locus ID 7799
UniProt ID Q13029
Cytogenetics 1p36.21
RefSeq ORF 678
Synonyms HUMHOXY1; KMT8; KMT8A; MTB-ZF; RIZ; RIZ1; RIZ2
Summary This tumor suppressor gene is a member of a nuclear histone/protein methyltransferase superfamily. It encodes a zinc finger protein that can bind to retinoblastoma protein, estrogen receptor, and the TPA-responsive element (MTE) of the heme-oxygenase-1 gene. Although the functions of this protein have not been fully characterized, it may (1) play a role in transcriptional regulation during neuronal differentiation and pathogenesis of retinoblastoma, (2) act as a transcriptional activator of the heme-oxygenase-1 gene, and (3) be a specific effector of estrogen action. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RIZ1 (PRDM2) (NM_001135610) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH327715 PRDM2 MS Standard C13 and N15-labeled recombinant protein (NP_001129082) 10 ug
$3,255.00
LC427635 PRDM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY427635 Transient overexpression lysate of PR domain containing 2, with ZNF domain (PRDM2), transcript variant 4 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.