SLC30A7 (NM_001144884) Human Recombinant Protein

CAT#: TP327524

Recombinant protein of human solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified SLC30A7 protein (Cat# TP327524). The protein was produced from HEK293T cells transfected with SLC30A7 cDNA clone (Cat# RC227524) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC227524 representing NM_001144884
  Red=Cloning site Green=Tags(s)
  
  MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSNCLGLISDSFH
  MFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAFFIFSEGVERALAPPDVHHER
  LLLVSILGFVVNLIGIFVFKHGGHGHSHGSGHGHSHSLFNGALDQAHGHVDHCHSHEVKHGAAHSHDHAH
  GHGHFHSHDGPSLKETTGPSRQILQGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVV
  SVIPLLRESVGILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARW
  ILSQTHNIFTQAGVRQLYVQIDFAAM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001138356
• Locus ID: 148867
• UniProt ID: Q8NEW0
• Cytogenetics: 1p21.2
• Refseq ORF: 1128
• Synonyms: ZnT-7; ZNT7; ZnTL2
• Summary: Zinc functions as a cofactor for numerous enzymes, nuclear factors, and hormones and as an intra- and intercellular signal ion. Members of the zinc transporter (ZNT)/SLC30 subfamily of the cation diffusion facilitator family, such as SLC30A7, permit cellular efflux of zinc (Seve et al., 2004 [PubMed 15154973]).[supplied by OMIM, Mar 2008]
• Protein Families: Transmembrane