Heme oxygenase 2 (HMOX2) (NM_001127205) Human Recombinant Protein

CAT#: TP325452L

Purified recombinant protein of Homo sapiens heme oxygenase (decycling) 2 (HMOX2), transcript variant 2, 1 mg

Product Images

Coomassie blue staining of purified HMOX2 protein (Cat# TP325452). The protein was produced from HEK293T cells transfected with HMOX2 cDNA clone (Cat# RC225452) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC225452 representing NM_001127205
  Red=Cloning site Green=Tags(s)
  
  MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLA
  TTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHY
  IGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALD
  LNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGS
  SCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001120677
• Locus ID: 3163
• UniProt ID: P30519
• Cytogenetics: 16p13.3
• Refseq Size: 1776
• Refseq ORF: 948
• Synonyms: HO-2
• Summary: Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Several alternatively spliced transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Oct 2013]
• Protein Families: Transmembrane
• Protein Pathways: Porphyrin and chlorophyll metabolism