AKR1CL2 (AKR1E2) (NM_001040177) Human Recombinant Protein

CAT#: TP324970

Recombinant protein of human aldo-keto reductase family 1, member C-like 2 (AKR1CL2), 20 µg

Product Images

Coomassie blue staining of purified AKR1E2 protein (Cat# TP324970). The protein was produced from HEK293T cells transfected with AKR1E2 cDNA clone (Cat# RC224970) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC224970 representing NM_001040177
  Red=Cloning site Green=Tags(s)
  
  MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKL
  WCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNM
  VIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFC
  QSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQV
  FDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPFHIEY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001035267
• Locus ID: 83592
• UniProt ID: Q96JD6
• Cytogenetics: 10p15.1
• Refseq Size: 1623
• Refseq ORF: 960
• Synonyms: AKR1CL2; AKRDC1; htAKR; hTSP; HTSP1; LoopADR; TAKR
• Summary: The protein encoded by this gene is a member of the aldo-keto reductase superfamily. Members in this family are characterized by their structure (evolutionarily highly conserved TIM barrel) and function (NAD(P)H-dependent oxido-reduction of carbonyl groups). Transcripts of this gene have been reported in specimens of human testis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
• Protein Families: Druggable Genome